Mouse Complement C3a Protein, His Tag
SKU: 89732689700

Mouse Complement C3a Protein, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse Complement C3a Protein, His TagProduct Specification Species Mouse Synonyms HSE MSF, Complement C3 alpha chain, Accession P01027 Amino Acid Sequence Protein sequence (P01027, Ser671 Arg748, with N His Tag) SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR Expression System HEK293 Molecular Weight Predicted MW: 10. 9 kDa Observed MW: 10. 9 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag with N His tag Physical Appearance

Product Specification


Species Mouse
Synonyms HSE-MSF, Complement C3 alpha chain,
Accession P01027
Amino Acid Sequence

Protein sequence (P01027, Ser671-Arg748, with N-His Tag) SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

Expression System HEK293
Molecular Weight Predicted MW: 10.9 kDa Observed MW: 10.9 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Complement C3a is a small bioactive peptide (77 amino acids) derived from the cleavage of complement component C3, a central protein in the complement system—a key part of innate immunity. C3a acts as an anaphylatoxin, binding to the C3a receptor (C3aR) on immune cells (e.g., mast cells, macrophages), triggering inflammation, chemotaxis, and cytokine release. It enhances immune responses against pathogens but can also contribute to inflammatory diseases (e.g., sepsis, asthma) if dysregulated. C3a also modulates tissue repair and metabolic processes, highlighting its dual role in immunity and homeostasis. Its functions are tightly regulated by the carboxypeptidase-mediated inactivation to C3a-desArg.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89732689700

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 640 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Aundrea
West Palm Beach, US
★★★★★ 5
powerful, efficient and long lasting
Color: Black
we've had this for a year and half now and it has held up!! we use it daily for coffee drinks. we also use it to mix powdered flavored drinks, when i do that it literally will make the WATER foam! its really powerful. and has definitely been worth the price as its lasted a year and a half.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
S
Verified Purchase
Soan Esteves
Cuba, US
★★★★★ 5
Great for fast frothing!!!
Color: Black
Very easy to use, the speed is fast enough for that little bit of froth in seconds, good for the price, battery lasts for days,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
T
Verified Purchase
Tonya
Los Angeles, US
★★★★★ 3
One speed level
Color: Black
The product currently operates at a single speed. While its performance is satisfactory, there is no option to reduce the speed. We kindly request the addition of an additional speed level for this item. 😒
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
D
Verified Purchase
Daryl
New York, US
★★★★★ 5
Creamy, Smooth, and Fresh — Perfect First Matcha Experience
Flavor Name: Superior Blend, Size: 1.4 Ounce (Pack of 1), Flavor Name: Superior Blend, Size: 1.4 Ounce (Pack of 1)
I tried the Naoki Superior Blend Matcha for the first time and was honestly impressed from day one. I prepared it with milk, and the matcha turned out incredibly creamy and smooth with a natural sweetness — no bitterness at all. The color was a vibrant bright green, which immediately made it feel fresh and high quality. You can tell this is not one of those dull, stale matcha powders. It mixed well and had a very clean, balanced flavor. As someone who was looking for authentic Japanese matcha without the marketing gimmicks, this felt like a great find. Looking forward to trying it next with just warm water to experience the flavor on its own.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
C
Verified Purchase
Charles
Phoenix, US
★★★★★ 5
Smooth like butter - Better than Jade leaf
Flavor Name: Superior Blend, Size: 3.5 Ounce (Pack of 1)
This stuff is smooth. No hint of bitterness in sight. Its so smooth I actually preferred to mix it 50/50 with Jade Leaf in my Matcha lattes. Its just amazing Matcha.. so good I started occasionally drinking it by itself not as a latte... the flavors present in just the tea (no milk, no sugar, etc) is insane. Umami, savory, very minimal mineral/bitter tastes. So if you like mineral tasting matcha, try Dens tea Restaurant Matcha... it has a very strong mineraly taste. This is almost the opposte. One thing to note, this stuff is so smooth and lacks bitterness that I actually have to use 3.5g instead of 3g like I do with Jade leaf... but once you get the strength dialed in it is MINT. I personally dont care about any clumping etc because I whisk my matcha with an electric frother in about 2 oz of water before adding milk or anything else.. even the matcha i had in my fridge which got clumpy from condensation didtn stand a chance... so if you ever have lumpy matcha.. its your fault, not the matchas fault. FYI. I dont mind the Jade leaf at all (for lattes)... in fact I wil gladly use it if its on sale.. but this is objectively the better matcha. If you plan to drink by itself, dont even consider jade leaf.. I am speaking specifically for lattes... Naoki is the only one you want to drink straight. But if you are a latte person.. either one is good quality and a buy again from me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026

recommand products